PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00063.45
Common NameAMTR_s00063p00154030, LOC18444567
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family bHLH
Protein Properties Length: 242aa    MW: 27266.1 Da    PI: 7.8911
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00063.45genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH48.22e-1563115155
                                              CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                                      HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                                              ++ +hn++Er RR+++Ns ++ Lr+llP++  +++k++s  ++++++ +YI +Lq
  evm_27.model.AmTr_v1.0_scaffold00063.45  63 KKLTHNANERDRRKKLNSLYSSLRSLLPES--EQGKRMSIPTTVTRVLKYIPELQ 115
                                              6789*************************6..49999***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474593.01E-1560130IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088813.99262114IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.107.4E-1263128IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.2E-1263115IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003532.0E-1068120IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010106Biological Processcellular response to iron ion starvation
GO:0055072Biological Processiron ion homeostasis
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MLALSPSCVY PTTFSWPSEE QLAPLNVESF NGDFSYHGDP HISQPFFQVS SENTESEQTS  60
NVKKLTHNAN ERDRRKKLNS LYSSLRSLLP ESEQGKRMSI PTTVTRVLKY IPELQKEVDS  120
LIQRREEILA RAPVQDNHRI PNANRGNVQG NSVPRITICR LDEGEMMVQI CASKMKRGQF  180
SKILIGLEEE GLMATDASSF SIGGHGVVYN LLLQVKEGFP RLDCEVLKDK ILWLCRMSKN  240
P*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006854796.10.0PREDICTED: transcription factor ORG2
TrEMBLU5D7C20.0U5D7C2_AMBTC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP28261129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.13e-35bHLH family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]